PDB entry 5may

View 5may on RCSB PDB site
Description: STRUCTURE OF THE LECB LECTIN FROM PSEUDOMONAS AERUGINOSA STRAIN PA14 IN COMPLEX WITH 2-Thiophenesulfonamide-N-(beta-L-fucopyranosyl methyl)
Class: sugar binding protein
Keywords: SUGAR BINDING PROTEIN, LECTIN, LECB, PSEUDOMONAS AERUGINOSA PA14, glycoinhibitors
Deposited on 2016-11-07, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: lecB, PA14_20610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5maya_
  • Chain 'B':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: lecB, PA14_20610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mayb_
  • Chain 'C':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: lecB, PA14_20610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mayc_
  • Chain 'D':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: lecB, PA14_20610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mayd_
  • Heterogens: CA, FUL, PK6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mayA (A:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mayB (B:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mayC (C:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mayD (D:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg