PDB entry 5maw

View 5maw on RCSB PDB site
Description: Crystal structure of the flagellin-FliS complex from Bacillus subtilis
Class: chaperone
Keywords: flagellum, type-3-secretion, chaperone
Deposited on 2016-11-07, released 2017-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Flagellin
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hag, BSU35360
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: flagellar protein FliS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FLIS, BSU35330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mawe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >5mawE (E:)
maiqnpytayqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqni
iqelnftlnrnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiq
serkdrhgsggia

    Sequence, based on observed residues (ATOM records): (download) 
    >5mawE (E:)
yqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftln
rnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqs