PDB entry 5mat

View 5mat on RCSB PDB site
Description: Structure of human Sirtuin 2 in complex with a selective thienopyrimidinone based inhibitor
Class: hydrolase
Keywords: NAD-dependent protein deacylase, sirtuin, inhibitor complex, hydrolase
Deposited on 2016-11-04, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IXJ6 (2-302)
      • expression tag (1)
    Domains in SCOPe 2.07: d5mata1, d5mata2
  • Chain 'C':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IXJ6 (2-302)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5matc1, d5matc2
  • Heterogens: ZN, 7KJ, SO4, PG4, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5matA (A:)
    hmerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlp
    ypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtle
    riagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdiv
    ffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqs
    dpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasid
    aqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5matA (A:)
    merlldeltlegvarymqsercrrviclvgagistsagipdfrstglydnlekyhlpype
    aifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleria
    gleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffg
    eslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpf
    lgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5matC (C:)
    hmerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlp
    ypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtle
    riagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdiv
    ffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqs
    dpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasid
    aqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5matC (C:)
    hmerlldeltlegvarymqsercrrviclvgagistsagipdfrsydnlekyhlpypeai
    feisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleriagl
    eqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffges
    lparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpflg
    mimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs