PDB entry 5man

View 5man on RCSB PDB site
Description: Structure of sucrose phosphorylase from Bifidobacterium adolescentis bound to nigerose
Class: transferase
Keywords: sucrose phosphorylase, resveratrol, enzyme design, transferase
Deposited on 2016-11-03, released 2017-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: sucrose phosphorylase
    Species: Bifidobacterium adolescentis [TaxId:1680]
    Gene: sucP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HQ2 (0-503)
      • conflict (191)
      • conflict (344)
    Domains in SCOPe 2.06: d5manb1, d5manb2
  • Heterogens: NGR, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5manB (B:)
    mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
    vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
    ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
    maashvsyirlnavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
    veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
    qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
    yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
    kalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpva
    mlewedsagdhrsddlianppvva