PDB entry 5m9v

View 5m9v on RCSB PDB site
Description: Human angiogenin PD/ALS variant R121C
Class: hydrolase
Keywords: Parkinson's, RNase, angiogenesis, ALS, HYDROLASE
Deposited on 2016-11-02, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANG, RNASE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered mutation (121)
    Domains in SCOPe 2.06: d5m9va_
  • Heterogens: TLA, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m9vA (A:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsi
    fcrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m9vA (A:)
    dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkn
    gnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifc
    r