PDB entry 5m9t

View 5m9t on RCSB PDB site
Description: Human angiogenin ALS variant H114R
Class: hydrolase
Keywords: ALS, RNase, angiogenesis, hydrolase
Deposited on 2016-11-02, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANG, RNASE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (1-123)
      • engineered mutation (114)
    Domains in SCOPe 2.06: d5m9ta_
  • Chain 'B':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANG, RNASE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered mutation (114)
    Domains in SCOPe 2.06: d5m9tb_
  • Heterogens: GOL, BO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m9tA (A:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvrldqsi
    frrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m9tA (A:)
    qdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvrldqsif
    rrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m9tB (B:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvrldqsi
    frrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m9tB (B:)
    nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
    nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvrldqsifrr