PDB entry 5m9r

View 5m9r on RCSB PDB site
Description: Human angiogenin ALS variant F100I
Class: hydrolase
Keywords: ALS, RNase, angiogenesis, hydrolase
Deposited on 2016-11-02, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANG, RNASE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (Start-123)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5m9ra_
  • Chain 'B':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANG, RNASE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (1-End)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5m9rb_
  • Heterogens: TAR, TLA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m9rA (A:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagirnvvvacenglpvhldqsi
    frrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m9rA (A:)
    dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkn
    gnphrenlriskssfqvttcklhggspwppcqyratagirnvvvacenglpvhldqsifr
    rp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m9rB (B:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagirnvvvacenglpvhldqsi
    frrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m9rB (B:)
    qdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagirnvvvacenglpvhldqsif
    r