PDB entry 5m9g

View 5m9g on RCSB PDB site
Description: Human angiogenin PD variant K54R
Class: hydrolase
Keywords: Parkinson's, RNase, angiogenesis, hydrolase
Deposited on 2016-11-01, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANG, RNASE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5m9ga_
  • Heterogens: TAR, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m9gA (A:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsiraicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsi
    frrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m9gA (A:)
    dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsiraicenkn
    gnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifr