PDB entry 5m94

View 5m94 on RCSB PDB site
Description: Crystal structure of Staphylococcus capitis divalent metal ion transporter (DMT) in complex with nanobody
Class: transport protein
Keywords: Transition Metal Ion Transporter, transport protein
Deposited on 2016-10-31, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Divalent metal cation transporter MntH
    Species: Staphylococcus capitis [TaxId:29388]
    Gene: mntH, BN1317_80025, SCAPIOD100025, SCAPIOD110024, SCAPIOD130025
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Camelid antibody fragment, nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M94 (Start-122)
    Domains in SCOPe 2.07: d5m94b_
  • Chain 'C':
    Compound: Divalent metal cation transporter MntH
    Species: Staphylococcus capitis [TaxId:29388]
    Gene: mntH, BN1317_80025, SCAPIOD100025, SCAPIOD110024, SCAPIOD130025
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Camelid antibody fragment, nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M94 (Start-122)
    Domains in SCOPe 2.07: d5m94d_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m94B (B:)
    gpqvqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnan
    yadsvkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m94B (B:)
    vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
    svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5m94D (D:)
    gpqvqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnan
    yadsvkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m94D (D:)
    vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
    svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss