PDB entry 5m6o

View 5m6o on RCSB PDB site
Description: Frutapin complexed with alpha-D-mannose
Class: carbohydrate-binding protein
Keywords: Plant lectin, Carbohydrate-binding protein, Complex
Deposited on 2016-10-25, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M6O (0-149)
    Domains in SCOPe 2.07: d5m6oa_
  • Chain 'B':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M6O (0-149)
    Domains in SCOPe 2.07: d5m6ob_
  • Chain 'C':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M6O (0-149)
    Domains in SCOPe 2.07: d5m6oc_
  • Chain 'D':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M6O (0-149)
    Domains in SCOPe 2.07: d5m6od_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m6oA (A:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m6oB (B:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m6oC (C:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m6oD (D:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal