PDB entry 5m6n

View 5m6n on RCSB PDB site
Description: Small Molecule inhibitors of IAP
Class: apoptosis
Keywords: XIAP, Apoptosis, metal-binding, inhibitor, Xiap#1
Deposited on 2016-10-25, released 2017-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC2, API1, MIHB, RNF48
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13490 (20-End)
      • expression tag (17-19)
    Domains in SCOPe 2.06: d5m6na1, d5m6na2
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC2, API1, MIHB, RNF48
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13490 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.06: d5m6nb1, d5m6nb2
  • Heterogens: ZN, SO4, 7H9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m6nA (A:)
    mgsshhhhhhssglvprgshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvk
    cfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m6nA (A:)
    gshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
    wvehakwfprceflirmkgqefvdeiqgryphlleqllst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m6nB (B:)
    mgsshhhhhhssglvprgshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvk
    cfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m6nB (B:)
    hmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddpwv
    ehakwfprceflirmkgqefvdeiqgryphll