PDB entry 5m6e

View 5m6e on RCSB PDB site
Description: Small Molecule inhibitors of IAP
Class: apoptosis
Keywords: XIAP, Apoptosis, metal-binding, inhibitor, Xiap#1
Deposited on 2016-10-25, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.07: d5m6ea1, d5m6ea2
  • Heterogens: ZN, NA, DMS, 7HT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m6eA (A:)
    mgsshhhhhhssglvprgshmnfpnstnlprnpsmadyeariftfgtwiysvnkeqlara
    gfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlths
    leeclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m6eA (A:)
    mnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggl
    tdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclv