PDB entry 5m6c

View 5m6c on RCSB PDB site
Description: crystal structure of t71n mutant of human hippocalcin
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 2016-10-24, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuron-specific calcium-binding protein hippocalcin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPCA, BDR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84074
      • engineered mutation (70)
    Domains in SCOPe 2.07: d5m6ca_
  • Chain 'E':
    Compound: Neuron-specific calcium-binding protein hippocalcin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPCA, BDR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84074
      • engineered mutation (70)
      • conflict (189)
    Domains in SCOPe 2.07: d5m6ce_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m6cA (A:)
    mgkqnsklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygd
    askfaehvfrnfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisree
    mleivqaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsiv
    rllqcdpssasqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m6cA (A:)
    sklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfa
    ehvfrnfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleiv
    qaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqc
    dps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5m6cE (E:)
    mgkqnsklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygd
    askfaehvfrnfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisree
    mleivqaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsiv
    rllqcdpsstsqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m6cE (E:)
    klrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfae
    hvfrnfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleivq
    aiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqcd
    psst