PDB entry 5m62

View 5m62 on RCSB PDB site
Description: Structure of the Mus musclus Langerin carbohydrate recognition domain in complex with glucose
Class: immune system
Keywords: C-TYPE LECTIN, GLYCOPROTEIN, CARBOHYDRATE BINDING PROTEIN, CALCIUM BINDING, CRD Domain, , LECTIN, IMMUNE SYSTEM
Deposited on 2016-10-24, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Mus musculus [TaxId:10090]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VBX4 (3-End)
      • expression tag (1-2)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d5m62a1, d5m62a2
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Mus musculus [TaxId:10090]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VBX4 (3-End)
      • expression tag (1-2)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d5m62b1, d5m62b2
  • Heterogens: CA, GOL, P6G, BGC, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m62A (A:)
    magilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaad
    giphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswn
    dgpcdntflfickrpyvqttegtwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m62A (A:)
    agilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadg
    iphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswnd
    gpcdntflfickrpyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m62B (B:)
    magilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaad
    giphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswn
    dgpcdntflfickrpyvqttegtwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m62B (B:)
    agilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadg
    iphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswnd
    gpcdntflfickrpyv