PDB entry 5m5e

View 5m5e on RCSB PDB site
Description: Crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor
Class: immune system
Keywords: Interleukine-2, interleukine-2 receptor, immune system, cytokine, interleukine-2 variant
Deposited on 2016-10-21, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Interleukin-2 receptor subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m5eb1, d5m5eb2
  • Chain 'C':
    Compound: Cytokine receptor common subunit gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m5ec1, d5m5ec2
  • Chain 'D':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M5E
    Domains in SCOPe 2.07: d5m5ed_
  • Heterogens: NAG, FUC, MAN, SO4, CYS, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m5eB (B:)
    avngtsqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswac
    nlilgapdsqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvvhveth
    rcnisweisqashyferhlefeartlspghtweeaplltlkqkqewicletltpdtqyef
    qvrvkplqgefttwspwsqplafrtkpaalgkdtgaqdkthtcppcpapellg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m5eB (B:)
    sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg
    apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvvhvethrcnis
    weisqashyferhlefeartlspghtweeaplltlkqkqewicletltpdtqyefqvrvk
    plqgefttwspwsqplafrtkpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5m5eC (C:)
    lnttiltpngnedttadfflttmptdslsvstlplpevqcfvfnveymnctwnsssepqp
    tnltlhywyknsdndkvqkcshylfseeitsgcqlqkkeihlyqtfvvqlqdpreprrqa
    tqmlklqnlvipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsv
    dyrhkfslpsvdgqkrytfrvrsrfnplcgsaqhwsewshpihwgsntskenpflfalea
    gaqdkthtcppcpapellg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m5eC (C:)
    lplpevqcfvfnveymnctwnsssepqptnltlhywyknsdndkvqkcshylfseeitsg
    cqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnlvipwapenltlhklsesqlelnw
    nnrflnhclehlvqyrtdwdhswteqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgsa
    qhwsewshpihwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5m5eD (D:)
    mgwsciilflvatatgvhsapassstkktqlqlehllldlqmilnginnyknpkltrmlt
    akfampkkatelkhlqcleeelkpleevlngaqsknfhlrprdlisninvivlelkgset
    tfmceyadetativeflnrwitfaqsiistltvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m5eD (D:)
    ssstkktqlqlehllldlqmilnginntrmltakfampkkatelkhlqcleeelkpleev
    lngaqshlrprdlisninvivlelkgsettfmceyadetativeflnrwitfaqsiistl
    t