PDB entry 5m3v

View 5m3v on RCSB PDB site
Description: BEAT Fc
Class: immune system
Keywords: Antibody TCR Bispecific Interface, Immune system
Deposited on 2016-10-17, released 2017-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region,Ig gamma-3 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (Start-119)
    • Uniprot P01860 (120-End)
      • engineered mutation (143)
      • engineered mutation (145)
      • engineered mutation (149)
      • engineered mutation (171)
      • engineered mutation (184)
      • engineered mutation (186)
      • engineered mutation (188)
      • engineered mutation (190)
    Domains in SCOPe 2.06: d5m3va1, d5m3va2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (126)
      • engineered mutation (128)
      • engineered mutation (130)
      • engineered mutation (143)
      • engineered mutation (145)
      • engineered mutation (149)
      • engineered mutation (173)
      • engineered mutation (176)
      • engineered mutation (178)
      • engineered mutation (184)
      • engineered mutation (186)
      • engineered mutation (188)
      • engineered mutation (190)
    Domains in SCOPe 2.06: d5m3vb1
  • Heterogens: NAG, BMA, MAN, GAL, FUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m3vA (A:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsreemtknqvklvclvtgfypsdiavewessgqpennyyttppmlds
    dgsfslvswlnvdksrwqqgnifscsvmhealhnrftqkslslspgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m3vA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
    emtknqvklvclvtgfypsdiavewessgqpennyyttppmldsdgsfslvswlnvdksr
    wqqgnifscsvmhealhnrftqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m3vB (B:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepevatfppsrdeltknqvtlvclvtgfypsdiavewesngqpennyktdpplles
    dgsfalssrlrvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m3vB (B:)
    vflfppkpkdtlmisrtpevtcvvfnwyvdgvevhnaktkpreevvsvltvlhqdwlngk
    eykcektiskakgqprepevatfppsrdeltknqvtlvclvtgfypsdiavewesngqpe
    nnyktdppllesdgsfalssrlrvdksrwqqgnvfscsvmhealhnhytqkslsls