PDB entry 5m3s

View 5m3s on RCSB PDB site
Description: Low-dose fixed target serial synchrotron crystallography structure of Metmyoglobin
Class: oxygen binding
Keywords: oxygen storage, OXYGEN BINDING
Deposited on 2016-10-17, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • conflict (122)
    Domains in SCOPe 2.06: d5m3sa_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m3sA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg