The last revision was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)
Chains and heterogens:
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
>5m3rA (A:) mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh pgnfgadaqgamnkalelfrkdiaakykelgyqg