PDB entry 5m2w

View 5m2w on RCSB PDB site
Description: Structure of nanobody nb18 raised against TssK from E. coli T6SS
Class: immune system
Keywords: T6SS TssK nanobody, immune system
Deposited on 2016-10-13, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Llama nanobody nb8 against TssK from T6SS
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M2W (0-End)
    Domains in SCOPe 2.07: d5m2wa1, d5m2wa2
  • Chain 'B':
    Compound: Llama nanobody nb8 against TssK from T6SS
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M2W (0-End)
    Domains in SCOPe 2.07: d5m2wb1, d5m2wb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m2wA (A:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m2wA (A:)
    qvqlvesggglvqaggtlklscaasgsgivvmawyrqapgkqrelvasitsggttnyads
    vkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m2wB (B:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m2wB (B:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvss