PDB entry 5m2q

View 5m2q on RCSB PDB site
Description: Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding protein in E.coli
Class: transport protein
Keywords: BtuF, Cobinamide, periplasmic binding protein, ABC transporter, Transport protein
Deposited on 2016-10-13, released 2017-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein A,Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A910
    • Uniprot P37028 (Start-268)
      • engineered mutation (68)
    Domains in SCOPe 2.06: d5m2qa_
  • Chain 'B':
    Compound: Outer membrane protein A,Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A910
      • linker (23)
    • Uniprot P37028 (24-End)
      • engineered mutation (68)
    Domains in SCOPe 2.06: d5m2qb1, d5m2qb2
  • Heterogens: CBY, CYN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m2qA (A:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstfqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m2qA (A:)
    aprvitlspantelafaagitpvgvssysdyppqaqkieqvstfqgmnlerivalkpdlv
    iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
    yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
    qvlarspqaivitgkipvipltsdwferaspriilaaqqlcnalsqvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m2qB (B:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstfqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m2qB (B:)
    maaprvitlspantelafaagitpvgvssysdyppqaqkieqvstfqgmnlerivalkpd
    lviawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqsll
    dqyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvs
    reqvlarspqaivitkipvipltsdwferaspriilaaqqlcnalsqv