PDB entry 5m2f

View 5m2f on RCSB PDB site
Description: Crystal structure of human AKR1B10 complexed with NADP+ and the synthetic retinoid UVI2008
Class: oxidoreductase
Keywords: TIM barrel, Aldo-Keto Reductase, Oxidoreductase, Synthetic Retinoid, Cytosolic
Deposited on 2016-10-12, released 2017-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Aldo-keto reductase family 1 member B10
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B10, AKR1B11
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60218 (0-315)
      • engineered mutation (124)
      • engineered mutation (300)
    Domains in SCOPe 2.06: d5m2fx_
  • Heterogens: NAP, UV8, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5m2fX (X:)
matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
dlfprddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
llqsshledypfnaey