PDB entry 5m2c

View 5m2c on RCSB PDB site
Description: Structural tuning of CD81LEL (space group P32 1 2)
Class: cell adhesion
Keywords: human cellular receptor for Hepatitis C virus, CELL ADHESION
Deposited on 2016-10-12, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m2ca_
  • Chain 'B':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m2cb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m2cA (A:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m2cA (A:)
    vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
    lcpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m2cB (B:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m2cB (B:)
    vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
    lcpsgsniisnlfkedchqkiddlfsgk