PDB entry 5m29

View 5m29 on RCSB PDB site
Description: Structure of cobinamide-bound BtuF, the periplasmic vitamin B12 binding protein in E.coli
Class: transport protein
Keywords: BtuF, Cobinamide, periplasmic binding protein, ABC transporter, Transport protein
Deposited on 2016-10-12, released 2017-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:83333]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m29a_
  • Chain 'B':
    Compound: Vitamin B12-binding protein
    Species: Escherichia coli [TaxId:83333]
    Gene: btuF, yadT, b0158, JW0154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m29b_
  • Heterogens: CBY, CYN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m29A (A:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhhx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m29A (A:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitgkipvipltsdwferaspriilaaqqlcnalsqvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m29B (B:)
    mkktaiaiavalagfatvaqaasmaaprvitlspantelafaagitpvgvssysdyppqa
    qkieqvstwqgmnlerivalkpdlviawrggnaerqvdqlaslgikvmwvdatsieqian
    alrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvflqfginppftsgkesiqn
    qvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywgeqlkipvi
    pltsdwferaspriilaaqqlcnalsqvdsgslevlfqgpggshhhhhhx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m29B (B:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitgkipvipltsdwferaspriilaaqqlcnalsqvd