PDB entry 5m23

View 5m23 on RCSB PDB site
Description: Modulation of MLL1 Methyltransferase Activity
Class: transferase
Keywords: MLL1 Methyltransferase peptide complex WDR5, transferase
Deposited on 2016-10-11, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR5, BIG3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m23a_
  • Heterogens: 7DC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m23A (A:)
    mgsshhhhhhssglvprgshmasmsdsevnqeakpevkpevkpethinlkvsdgsseiff
    kikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedldmedndiieahreqig
    gsatqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfe
    ktisghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpq
    snlivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdt
    asgqclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghkneky
    cifanfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaa
    lendktiklwksdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m23A (A:)
    pnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgisd
    vawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfdes
    vriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktlidd
    dnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtggk
    wivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwks