PDB entry 5m22

View 5m22 on RCSB PDB site
Description: crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3
Deposited on 2016-10-11, released 2017-09-27
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroquinone dioxygenase small subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hydroquinone dioxygenase large subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hydroquinone dioxygenase small subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Hydroquinone dioxygenase large subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hydroquinone dioxygenase small subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Hydroquinone dioxygenase large subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Hydroquinone dioxygenase small subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Hydroquinone dioxygenase large subunit
    Species: Sphingomonas sp. TTNP3 [TaxId:436446]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5m22A (A:)
    madvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesa
    raegtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgr
    ivlrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqteaa
    

    Sequence, based on observed residues (ATOM records):
    >5m22A (A:)
    dvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesara
    egtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgriv
    lrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqte
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5m22B (B:)
    mamsealeiidfgdskartdtehlainnetgyrsfraggftftrdeyfarltwpggshii
    pidaflrammrdvawgffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfk
    ssalmavfkdilsdwtvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgd
    tpvrtdangfpvnrqfadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvv
    gdslfcptseefilpvehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmp
    adirhqgystkrsmllvwengspkipqmiadgtapvvpvtf
    

    Sequence, based on observed residues (ATOM records):
    >5m22B (B:)
    artdtehlainnetgyrsfraggftftrdeyfarltwpggshiipidaflrammrdvawg
    ffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfkssalmavfkdilsdwt
    vegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgdtpvrtdangfpvnrqf
    advpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvvgdslfcptseefilpv
    ehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmpadirhqgystkrsmll
    vwengspkipqmiadgtapvvpvtf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5m22C (C:)
    madvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesa
    raegtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgr
    ivlrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqteaa
    

    Sequence, based on observed residues (ATOM records):
    >5m22C (C:)
    dvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesara
    egtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgriv
    lrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqte
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5m22D (D:)
    mamsealeiidfgdskartdtehlainnetgyrsfraggftftrdeyfarltwpggshii
    pidaflrammrdvawgffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfk
    ssalmavfkdilsdwtvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgd
    tpvrtdangfpvnrqfadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvv
    gdslfcptseefilpvehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmp
    adirhqgystkrsmllvwengspkipqmiadgtapvvpvtf
    

    Sequence, based on observed residues (ATOM records):
    >5m22D (D:)
    skartdtehlainnetgyrsfraggftftrdeyfarltwpggshiipidaflrammrdva
    wgffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfkssalmavfkdilsd
    wtvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgdtpvrtdangfpvnr
    qfadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvvgdslfcptseefil
    pvehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmpadirhqgystkrsm
    llvwengspkipqmiadgpvvpvtf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5m22E (E:)
    madvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesa
    raegtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgr
    ivlrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqteaa
    

    Sequence, based on observed residues (ATOM records):
    >5m22E (E:)
    dvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesara
    egtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgriv
    lrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqtea
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5m22F (F:)
    mamsealeiidfgdskartdtehlainnetgyrsfraggftftrdeyfarltwpggshii
    pidaflrammrdvawgffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfk
    ssalmavfkdilsdwtvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgd
    tpvrtdangfpvnrqfadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvv
    gdslfcptseefilpvehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmp
    adirhqgystkrsmllvwengspkipqmiadgtapvvpvtf
    

    Sequence, based on observed residues (ATOM records):
    >5m22F (F:)
    kartdtehlainnetgyrsfraggftftrdeyfarltwpggshiipidaflrammrdvaw
    gffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfkssalmavfkdilsdw
    tvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgdtpvrtdangfpvnrq
    fadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvvgdslfcptseefilp
    vehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmpadirhqgystkrsml
    lvwengspkipqmiadgtapvvpvtf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5m22G (G:)
    madvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesa
    raegtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgr
    ivlrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicqteaa
    

    Sequence, based on observed residues (ATOM records):
    >5m22G (G:)
    dvvtefgaltdyrkggveiidddprnyvfsnvfevaanaapyervavgknfeyviesara
    egtsgwfscahdefvlamdgqievhllkldnsdayvdpdsegavaigealpegrkmgriv
    lrrghmallpvgaayrfyaeqpaamlfqsiegavtvqkwgeicq
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5m22H (H:)
    mamsealeiidfgdskartdtehlainnetgyrsfraggftftrdeyfarltwpggshii
    pidaflrammrdvawgffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfk
    ssalmavfkdilsdwtvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgd
    tpvrtdangfpvnrqfadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvv
    gdslfcptseefilpvehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmp
    adirhqgystkrsmllvwengspkipqmiadgtapvvpvtf
    

    Sequence, based on observed residues (ATOM records):
    >5m22H (H:)
    iidfgdskartdtehlainnetgyrsfraggftftrdeyfarltwpggshiipidaflra
    mmrdvawgffygvvnfdhvfgtinhygevtmfagrfndayrnagrdheerfkssalmavf
    kdilsdwtvegydpfaapmetglpwgikngnndeaisrqrvtarrmvglpgdtpvrtdan
    gfpvnrqfadvpqeqpvveaepgfeaevsaynlfgylsrsdvtwnpsvcsvvgdslfcpt
    seefilpvehgndrcewflqlsdeivwdvkdkesgkprarvtaragdiccmpadirhqgy
    stkrsmllvwengspkipqmidgtapvvpvt