PDB entry 5m1t

View 5m1t on RCSB PDB site
Description: pamucr phosphodiesterase, c-di-gmp complex
Deposited on 2016-10-10, released 2017-03-01
The last revision was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MucR Phosphodiesterase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA1727
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MucR Phosphodiesterase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA1727
    Database cross-references and differences (RAF-indexed):
  • Heterogens: C2E, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5m1tA (A:)
    mgsshhhhhhssglvprgshmsmnanaqeqlqllhdlrqalerrqlvlhyqpkvlapngp
    migveallrwehpqhglitpgqflplaektglivqigewvldeacrqmrlwldgghadwn
    iavnlsalqfahaglvdsvrnallrhslepshlilevtestamrdadaslvileqlsamg
    vgisiddfgtgyssllylkrlpaselkidrgfinelahdsddaaivsaivalgrtlnlki
    vaegveteaqqefltrlgcnslqgfllgrpmpaeqllasva
    

    Sequence, based on observed residues (ATOM records):
    >5m1tA (A:)
    lqllhdlrqalerrqlvlhyqpkvlapngpmigveallrwehpqhglitpgqflplaekt
    glivqigewvldeacrqmrlwldgghadwniavnlsalqfahaglvdsvrnallrhslep
    shlilevtestamrdadaslvileqlsamgvgisiddfgtgyssllylkrlpaselkidr
    gfinelahdsddaaivsaivalgrtlnlkivaegveteaqqefltrlgcnslqgfllgrp
    mpaeqll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5m1tB (B:)
    mgsshhhhhhssglvprgshmsmnanaqeqlqllhdlrqalerrqlvlhyqpkvlapngp
    migveallrwehpqhglitpgqflplaektglivqigewvldeacrqmrlwldgghadwn
    iavnlsalqfahaglvdsvrnallrhslepshlilevtestamrdadaslvileqlsamg
    vgisiddfgtgyssllylkrlpaselkidrgfinelahdsddaaivsaivalgrtlnlki
    vaegveteaqqefltrlgcnslqgfllgrpmpaeqllasva
    

    Sequence, based on observed residues (ATOM records):
    >5m1tB (B:)
    rqlvlhyqpkvlapngpmigveallrwglitpgqflplaektglivqigewvldeacrqm
    rlwladwniavnlsalqfahaglvdsvrnallrhslepshlilevtestamrdadaslvi
    leqlsamgvgisiddfgtgyssllylkrlpaselkidrgfinelahdsddaaivsaival
    grtlnlkivaegveteaqqefltrlgcnslqgfllgrpmpaeqll