PDB entry 5m1f

View 5m1f on RCSB PDB site
Description: crystal structure of the large terminase nuclease from thermophilic phage g20c
Deposited on 2016-10-07, released 2016-10-26
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage terminase large subunit
    Species: Thermus phage G20c [TaxId:1406341]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7XXR1 (4-End)
      • expression tag (3)
      • conflict (62)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5m1fA (A:)
    gpamnsvfsgldmlillpyerrgtrlvvedyrpdhiycigadfgknqdysvfsvldldtg
    aiaclermngatwsdqvarlkalsedyghayvvadtwgvgdaiaeeldaqginytplpvk
    sssvkeqlisnlallmekgqvavpndktildelrnfryyrtasgnqvmraygrghddivm
    slalaysqyeg
    

    Sequence, based on observed residues (ATOM records):
    >5m1fA (A:)
    mnsvfsgldmlillpyerrgtrlvvedyrpdhiycigadfgknqdysvfsvldldtgaia
    clermngatwsdqvarlkalsedyghayvvadtwvgdaiaeeldaqginytplpvksssv
    keqlisnlallmekgqvavpndktildelrnfryyrtasgnqvmraygrghddivmslal
    aysqye