PDB entry 5m11

View 5m11 on RCSB PDB site
Description: structural and functional probing of porz, an essential bacterial surface component of the type-ix secretion system of human oral- microbiomic porphyromonas gingivalis.
Deposited on 2016-10-07, released 2016-11-09
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoreactive 84kD antigen PG93
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: PorZ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ZN, CAC, CL, PG4, PEG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5m11A (A:)
    gplgspefpggiwntllaihktekavetpkkvfavangvlysvgkeapheakifdrisgl
    sdtsvssiayseqlkslviyyasgnidildeagrvtnvpalkdnidlidktlnrllivgn
    raylaggfglsvldvaearipatyakgtkvtdvakldndrllmlkegqlfigketdnlqd
    paawtalslnlpmgsvtglgivgedicflladgrvyvaanqsfepelllsssadsrlyvt
    drglficaenriyfiekgrkttqfpiadvlgvgamnesntayialgeeglaslllaegst
    aeampvafdgpgdndfyemrfshgrlyaasglwgtnlmghagmvklydgnrwtnfdkktv
    qeqlgggfsfndaidiavsngdpdhffvgtwgnglfefkdgkaiarysgnetaiaecnpg
    darvkaiafdnkgnlwgtlgavgknifmydpqsstwhsfsypdvanlasfgnmiilpngd
    kwvnilhrsggstrkgvlifndrgtpettsddshlyveqfvnrlgaaighktiyamavdh
    ngsvwmgsdigifgvynaagvlsststpiavrpvggeepnlyyvldkvtvtdivvdklnh
    kwvatqgtglyllsedcskilaqftvenspllsnnilslalnddngllyigtadglmtfq
    tgtgsgsaseldgvyvypnplrpeypdgvtiaglqagcsvkitdttgrllyqtesvttev
    kwnargadgnrvasgvyavavydpvskksklirfavir
    

    Sequence, based on observed residues (ATOM records):
    >5m11A (A:)
    giwntllaihktekavetpkkvfavangvlysvgkeapheakifdrisglsdtsvssiay
    seqlkslviyyasgnidildeagrvtnvpalkdnidlidktlnrllivgnraylaggfgl
    svldvaearipatyakgtkvtdvakldndrllmlkegqlfigketdnlqdpaawtalsln
    lpmgsvtglgivgedicflladgrvyvaanqsfepelllsssadsrlyvtdrglficaen
    riyfiekgrkttqfpiadvlgvgamnesntayialgeeglaslllaegstaeampvafdg
    pgdndfyemrfshgrlyaasglwgtnlmghagmvklydgnrwtnfdkktvqeqlgggfsf
    ndaidiavsngdpdhffvgtwgnglfefkdgkaiarysgnetaiaecnpgdarvkaiafd
    nkgnlwgtlgavgknifmydpqsstwhsfsypdvanlasfgnmiilpngdkwvnilhrsg
    gstrkgvlifndrgtpettsddshlyveqfvnrlgaaighktiyamavdhngsvwmgsdi
    gifgvynaagvlsststpiavrpvggeepnlyyvldkvtvtdivvdklnhkwvatqgtgl
    yllsedcskilaqftvenspllsnnilslalnddngllyigtadglmtfqtgtgsgsase
    ldgvyvypnplrpeypdgvtiaglqagcsvkitdttgrllyqtesvttevkwnargadgn
    rvasgvyavavydpvskksklirfavir