PDB entry 5m0y

View 5m0y on RCSB PDB site
Description: Crystal Structure of the CohScaA-XDocCipB type II complex from Clostridium thermocellum at 1.5Angstrom resolution
Class: cell adhesion
Keywords: cellulosome, plant cell wall degradation, protein-protein interaction, cohesin-dockerin complex, cell adhesion
Deposited on 2016-10-06, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosome anchoring protein cohesin region
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_1307
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DF10 (Start-177)
      • conflict (112)
      • conflict (146)
      • expression tag (178)
    Domains in SCOPe 2.07: d5m0ya1, d5m0ya2
  • Chain 'B':
    Compound: Ig domain protein group 2 domain protein
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m0yb1, d5m0yb2
  • Heterogens: CA, SO4, GOL, EDO, PGE, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m0yA (A:)
    masradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetg
    keftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvteesgiia
    kigfkilqkkstavkfqdtlsmpgailgtqlfdwdgevitgyeviqpdvlslgdepyeve
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m0yA (A:)
    dkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkefts
    stfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvteesgiiakigfk
    ilqkkstavkfqdtlsmpgailgtqlfdwdgevitgyeviqpdvlslgdepyev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m0yB (B:)
    mnndstdkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgd
    mreftleiskrnylkrnvtvngtgklvvstednplilwagdverkgvqdnainmvdvmei
    skvfgtragdeeyvaeldlnmdgainlfdiaivirhfnalpsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m0yB (B:)
    kttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftle
    iskrnylkrnvtvngtgklvvstednplilwagdverkgvqdnainmvdvmeiskvfgtr
    agdeeyvaeldlnmdgainlfdiaivirhfnalpsry