PDB entry 5m0w

View 5m0w on RCSB PDB site
Description: n-terminal domain of mouse shisa 3
Deposited on 2016-10-06, released 2017-04-05
The last revision was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein shisa-3 homolog
    Species: Mus musculus [TaxId:10090]
    Gene: Shisa3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, EDO, MES, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5m0wA (A:)
    eqpgeychgwvdaqgnyhegfqcpedfdtqdaticcgscalryccaaadarleqggctnd
    rgelehpgitaqpvwshpqfek
    

    Sequence, based on observed residues (ATOM records):
    >5m0wA (A:)
    eqpgeychgwvdaqgnyhegfqcpedfdtqdaticcgscalryccaaadarleqggctnd
    rge