PDB entry 5m0n

View 5m0n on RCSB PDB site
Description: Crystal structure of cytochrome P450 OleT in complex with formate
Class: oxidoreductase
Keywords: cytochrome P450, decarboxylase, oxidase, peroxide, oxidoreductase
Deposited on 2016-10-05, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal olefin-forming fatty acid decarboxylase
    Species: Jeotgalicoccus sp. ATCC 8456 [TaxId:946435]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9NSU2 (6-427)
      • expression tag (5)
    Domains in SCOPe 2.07: d5m0na1, d5m0na2
  • Heterogens: HEM, SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m0nA (A:)
    hhhhhhmatlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkeg
    aemfynndvvqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvrel
    trtlwhantqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfr
    alggafkgykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsr
    tcaidlmntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpf
    lpgkakvdidfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipq
    gggdywtnhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfvikn
    vrevvdrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m0nA (A:)
    hmatlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfy
    nndvvqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlw
    hantqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralgga
    fkgykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaid
    lmntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgka
    kvdidfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdy
    wtnhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevv
    drt