PDB entry 5m07

View 5m07 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis PknI kinase domain, C20A mutant
Class: signaling protein
Keywords: Tuberculosis, kinase, signalling, transferase, signaling protein
Deposited on 2016-10-03, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PknI
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: pknI, Rv2914c, MTCY338.02c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WI69 (20-275)
      • engineered mutation (39)
    Domains in SCOPe 2.06: d5m07a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PknI
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: pknI, Rv2914c, MTCY338.02c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WI69 (20-275)
      • engineered mutation (39)
    Domains in SCOPe 2.06: d5m07b_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m07A (A:)
    mgsshhhhhhssglvprgshmalasgvtfagytvvrmlgasamgevylvqhpgfpgwqal
    kvlspamaaddefrrrfqretevaarlfhphilevhdrgefdgqlwiamdyvdgidatqh
    madrfpavlpvgevlaivtavagaldyahqrgllhrdvnpanvvltsqsagdqrilladf
    giasqpsypapelsagadvdgradqyalaltaihlfagappvdrshtgplqppklsafrp
    dlarldgvlsralatapadrfgscrefadamneqag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m07A (A:)
    malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
    tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
    vagaldyahqrgllhrdvnpanvvltsqdqrilladfgiasqpsypapelsagadvdgra
    dqyalaltaihlfagappvdrlqppklsafrpdlarldgvlsralatapadrfgscrefa
    damneqag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m07B (B:)
    mgsshhhhhhssglvprgshmalasgvtfagytvvrmlgasamgevylvqhpgfpgwqal
    kvlspamaaddefrrrfqretevaarlfhphilevhdrgefdgqlwiamdyvdgidatqh
    madrfpavlpvgevlaivtavagaldyahqrgllhrdvnpanvvltsqsagdqrilladf
    giasqpsypapelsagadvdgradqyalaltaihlfagappvdrshtgplqppklsafrp
    dlarldgvlsralatapadrfgscrefadamneqag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m07B (B:)
    malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
    tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
    vagaldyahqrgllhrdvnpanvvltsqrilladfgiasqpsypapelsagadvdgradq
    yalaltaihlfagappvdrslqppklsafrpdlarldgvlsralatapadrfgscrefad
    amneqag