PDB entry 5m06

View 5m06 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis PknI kinase domain
Class: signaling protein
Keywords: Tuberculosis, kinase, signalling, signaling protein
Deposited on 2016-10-03, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PknI
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: pknI, Rv2914c, MTCY338.02c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m06a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PknI
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: pknI, Rv2914c, MTCY338.02c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m06b_
  • Heterogens: ADP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m06A (A:)
    mgsshhhhhhssglvprgshmalasgvtfagytvvrmlgcsamgevylvqhpgfpgwqal
    kvlspamaaddefrrrfqretevaarlfhphilevhdrgefdgqlwiamdyvdgidatqh
    madrfpavlpvgevlaivtavagaldyahqrgllhrdvnpanvvltsqsagdqrilladf
    giasqpsypapelsagadvdgradqyalaltaihlfagappvdrshtgplqppklsafrp
    dlarldgvlsralatapadrfgscrefadamneqag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m06A (A:)
    malasgvtfagytvvrmlgcsamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
    tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
    vagaldyahqrgllhrdvnpanvvltsrilladfgiasqpsypapelsagadvdgradqy
    alaltaihlfagappvdrslqppklsafrpdlarldgvlsralatapadrfgscrefada
    mneqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m06B (B:)
    mgsshhhhhhssglvprgshmalasgvtfagytvvrmlgcsamgevylvqhpgfpgwqal
    kvlspamaaddefrrrfqretevaarlfhphilevhdrgefdgqlwiamdyvdgidatqh
    madrfpavlpvgevlaivtavagaldyahqrgllhrdvnpanvvltsqsagdqrilladf
    giasqpsypapelsagadvdgradqyalaltaihlfagappvdrshtgplqppklsafrp
    dlarldgvlsralatapadrfgscrefadamneqag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m06B (B:)
    alasgvtfagytvvrmlgcsamgevylvqhpgfpgwqalkvlspamaaddefrrrfqret
    evaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivtav
    agaldyahqrgllhrdvnpanvvltsgdqrilladfgiasqpsypapelsagadvdgrad
    qyalaltaihlfagappvdrsplqppklsafrpdlarldgvlsralatapadrfgscref
    adamneqa