PDB entry 5m00

View 5m00 on RCSB PDB site
Description: Crystal structure of murine P14 TCR complex with H-2Db and Y4A, modified gp33 peptide from LCMV
Class: immune system
Keywords: MHC class I, TCR, H-2Db, gp33, LCMV, immune system
Deposited on 2016-10-03, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m00a1, d5m00a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (20-118)
      • cloning artefact (18-19)
      • conflict (104)
    Domains in SCOPe 2.07: d5m00b1, d5m00b2
  • Chain 'G':
    Compound: Protein Trav14-1,Uncharacterized protein
    Species: Mus musculus [TaxId:10090]
    Gene: Trav14-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0G2JF94 (Start-98)
      • linker (99-118)
    • Uniprot Q6PIR9 (119-End)
      • conflict (165)
    Domains in SCOPe 2.07: d5m00g1, d5m00g2
  • Chain 'H':
    Compound: T-cell receptor beta chain V region C5,Uncharacterized protein
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04213 (0-91)
      • linker (92-108)
    • Uniprot Q7TND8 (109-End)
      • conflict (167)
      • conflict (181)
    Domains in SCOPe 2.07: d5m00h1, d5m00h2
  • Chain 'P':
    Compound: lcmv-derived gp33 altered peptide ligand y4a
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5M00 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m00A (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m00B (B:)
    marsvtlvflvlvsltglmgiqktpqiqvysrhppengkpnilncyvtqfhpphieiqml
    kngkkipkvemsdmsfskdwsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m00B (B:)
    mgiqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfsk
    dwsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5m00G (G:)
    qqkekhdqqqvrqspqsltvweggttvltcsyedstfnyfpwyqqfpgegpallisilsv
    sdkkedgrfttffnkrekklslhiidsqpgdsatyfcaalygnekitfgagtkltikpni
    qnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksnga
    iawsnqtsftcqdifketnatypss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m00G (G:)
    qqvrqspqsltvweggttvltcsyedstfnyfpwyqqfpgegpallisilsvsdkkedgr
    fttffnkrekklslhiidsqpgdsatyfcaalygnekitfgagtkltikpniqnpepavy
    qlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkadsksngaiawsnqtsf
    tcqdifk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5m00H (H:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcassdaggrntlyfgagtrlsvledlrnvtpp
    kvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnys
    yslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m00H (H:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcassdaggrntlyfgagtrlsvledlrnvtpp
    kvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnys
    yslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad
    

  • Chain 'P':
    No sequence available.