PDB entry 5lzk

View 5lzk on RCSB PDB site
Description: structure of the domain of unknown function duf1669 from human fam83b
Deposited on 2016-09-29, released 2016-10-26
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein FAM83B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM83B, C6orf143
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein FAM83B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM83B, C6orf143
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lzkA (A:)
    smggthidllfhpprahlltiketirkmikearkvialvmdiftdvdifkeiveastrgv
    svyilldesnfnhflnmtekqgcsvqrlrnirvrtvkgqdylsktgakfhgkmeqkfllv
    dcqkvmygsysymwsfekahlsmvqiitgqlvesfdeefrtlyarscvpssfaqeesarv
    

    Sequence, based on observed residues (ATOM records):
    >5lzkA (A:)
    gthidllfhpprahlltiketirkmikearkvialvmdiftdvdifkeiveastrgvsvy
    illdesnfnhflnmtekqgcsvqrlrnirvrtvkgqdylsktgakfhgkmeqkfllvdcq
    kvmygsysymwsfekahlsmvqiitgqlvesfdeefrtlyarscvpssf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lzkB (B:)
    smggthidllfhpprahlltiketirkmikearkvialvmdiftdvdifkeiveastrgv
    svyilldesnfnhflnmtekqgcsvqrlrnirvrtvkgqdylsktgakfhgkmeqkfllv
    dcqkvmygsysymwsfekahlsmvqiitgqlvesfdeefrtlyarscvpssfaqeesarv
    

    Sequence, based on observed residues (ATOM records):
    >5lzkB (B:)
    gthidllfhpprahlltiketirkmikearkvialvmdiftdvdifkeiveastrgvsvy
    illdesnfnhflnmtekqgcsvqrlrnirvrtvkgqdylsktgakfhgkmeqkfllvdcq
    kvmygsysymwsfekahlsmvqiitgqlvesfdeefrtlyarscvpssf