PDB entry 5lzj

View 5lzj on RCSB PDB site
Description: Cholera toxin El Tor B-pentamer in complex with inhibitor Laura237
Class: toxin
Keywords: cholera toxin B-pentamer, inhibitor, toxin
Deposited on 2016-09-29, released 2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lzja_
  • Chain 'B':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lzjb_
  • Chain 'C':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lzjc_
  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lzjd_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lzje_
  • Heterogens: SO4, PEG, PGE, 7BT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzjA (A:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzjB (B:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzjC (C:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzjD (D:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzjE (E:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman