PDB entry 5lzj
View 5lzj on RCSB PDB site
Description: Cholera toxin El Tor B-pentamer in complex with inhibitor Laura237
Class: toxin
Keywords: cholera toxin B-pentamer, inhibitor, toxin
Deposited on
2016-09-29, released
2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated
2017-05-31, with a file datestamp of
2017-05-26.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cholera enterotoxin subunit B
Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
Gene: ctxB, toxB, VC_1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5lzja_ - Chain 'B':
Compound: Cholera enterotoxin subunit B
Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
Gene: ctxB, toxB, VC_1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5lzjb_ - Chain 'C':
Compound: Cholera enterotoxin subunit B
Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
Gene: ctxB, toxB, VC_1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5lzjc_ - Chain 'D':
Compound: Cholera enterotoxin subunit B
Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
Gene: ctxB, toxB, VC_1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5lzjd_ - Chain 'E':
Compound: Cholera enterotoxin subunit B
Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
Gene: ctxB, toxB, VC_1456
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5lzje_ - Heterogens: SO4, PEG, PGE, 7BT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5lzjA (A:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5lzjB (B:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5lzjC (C:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5lzjD (D:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>5lzjE (E:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman