PDB entry 5lzh

View 5lzh on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with inhibitor PC262
Class: toxin
Keywords: cholera toxin B-pentamer, inhibitor, TOXIN
Deposited on 2016-09-29, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lzha_
  • Chain 'B':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lzhb_
  • Chain 'C':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lzhc_
  • Chain 'D':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lzhd_
  • Chain 'E':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lzhe_
  • Heterogens: 7BO, MRD, CA, TRS, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzhA (A:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzhB (B:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzhC (C:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzhD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lzhE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman