PDB entry 5lzg

View 5lzg on RCSB PDB site
Description: Cholera toxin El Tor B-pentamer in complex with inhibitor PC262
Class: toxin
Keywords: cholera toxin B-pentamer, inhibitor, TOXIN
Deposited on 2016-09-29, released 2017-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lzga_
  • Chain 'B':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lzgb_
  • Chain 'C':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lzgc_
  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lzgd_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lzge_
  • Heterogens: 7BN, TRS, IMD, PEG, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lzgA (A:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lzgB (B:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lzgC (C:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lzgD (D:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lzgE (E:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman