PDB entry 5lz0

View 5lz0 on RCSB PDB site
Description: Llama nanobody PorM_01
Class: immune system
Keywords: nanobody, Porphyromonas gingivalis, Type-9 Secretion System (T9SS), immune system
Deposited on 2016-09-29, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PorM nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LZ0
    Domains in SCOPe 2.07: d5lz0a1, d5lz0a2
  • Chain 'B':
    Compound: PorM nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LZ0
    Domains in SCOPe 2.07: d5lz0b1, d5lz0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lz0A (A:)
    madvqlvesggglvqaggslrvscaasgrtfssysmgwfrqapgkerefvaaisrsdnst
    yyadsvkgrftisrdsakntvylqmnslkpedtavyycaatpygsryylrelreydywgq
    gtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lz0A (A:)
    qlvesggglvqaggslrvscaasgrtfssysmgwfrqapgkerefvaaisrsdnstyyad
    svkgrftisrdsakntvylqmnslkpedtavyycaatpygsryylrelreydywgqgtqv
    tvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lz0B (B:)
    madvqlvesggglvqaggslrvscaasgrtfssysmgwfrqapgkerefvaaisrsdnst
    yyadsvkgrftisrdsakntvylqmnslkpedtavyycaatpygsryylrelreydywgq
    gtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lz0B (B:)
    qlvesggglvqaggslrvscaasgrtfssysmgwfrqapgkerefvaaisrsdnstyyad
    svkgrftisrdsakntvylqmnslkpedtavyycaatpygsryylrelreydywgqgtqv
    tvss