PDB entry 5lyo

View 5lyo on RCSB PDB site
Description: crystal structure of the zymogen matriptase catalytic domain
Deposited on 2016-09-28, released 2017-10-25
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Suppressor of tumorigenicity 14 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ST14, PRSS14, SNC19, TADG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5Y6 (13-264)
      • expression tag (12)
      • engineered mutation (23)
      • engineered mutation (181)
      • engineered mutation (214)
  • Chain 'B':
    Compound: Suppressor of tumorigenicity 14 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ST14, PRSS14, SNC19, TADG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5Y6 (13-264)
      • expression tag (10-12)
      • engineered mutation (181)
      • engineered mutation (214)
  • Chain 'C':
    Compound: Suppressor of tumorigenicity 14 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ST14, PRSS14, SNC19, TADG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5Y6 (13-264)
      • expression tag (10-12)
      • engineered mutation (23)
      • engineered mutation (181)
      • engineered mutation (214)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lyoA (A:)
    smnshhhhhhgtacglrsftrqaavvggtdadegewpwqvslhalgqghicgaslispnw
    lvsaahcyiddrgfrysdptqwtaflglhdqsqrsapgvqerrlkriishpffndftfdy
    diallelekpaeyssmvrpiclpdashvfpagkaiwvtgwghtqyggtgalilqkgeirv
    iqqttcenllpqqitprmmcvgflsggvdscqgdaggplssveadgrifqagvvswgdgc
    aqrnkpgvytrlplfrdwikentgv
    

    Sequence, based on observed residues (ATOM records):
    >5lyoA (A:)
    acglrsftrqaavvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddr
    gfrysdptqwtaflglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpae
    yssmvrpiclpdashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpq
    qitprmmcvgflsggvdscqgdaggplssveadgrifqagvvswgdgcaqrnkpgvytrl
    plfrdwikentgv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lyoB (B:)
    smnshhhhhhgtacglrsftrqaavvggtdadegewpwqvslhalgqghicgaslispnw
    lvsaahcyiddrgfrysdptqwtaflglhdqsqrsapgvqerrlkriishpffndftfdy
    diallelekpaeyssmvrpiclpdashvfpagkaiwvtgwghtqyggtgalilqkgeirv
    iqqttcenllpqqitprmmcvgflsggvdscqgdaggplssveadgrifqagvvswgdgc
    aqrnkpgvytrlplfrdwikentgv
    

    Sequence, based on observed residues (ATOM records):
    >5lyoB (B:)
    gtacglrsftrqaggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrg
    frysdptqwtaflglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaey
    ssmvrpiclpdashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpqq
    itprmmcvgflsggvdscqgdaggplssveadgrifqagvvswgdgcaqrnkpgvytrlp
    lfrdwikentgv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lyoC (C:)
    smnshhhhhhgtacglrsftrqaavvggtdadegewpwqvslhalgqghicgaslispnw
    lvsaahcyiddrgfrysdptqwtaflglhdqsqrsapgvqerrlkriishpffndftfdy
    diallelekpaeyssmvrpiclpdashvfpagkaiwvtgwghtqyggtgalilqkgeirv
    iqqttcenllpqqitprmmcvgflsggvdscqgdaggplssveadgrifqagvvswgdgc
    aqrnkpgvytrlplfrdwikentgv
    

    Sequence, based on observed residues (ATOM records):
    >5lyoC (C:)
    gtacglrsftrqaavvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyid
    drgfrysdptqwtaflglhdqsqrsapgvqerrlkriishpffndftfdydiallelekp
    aeyssmvrpiclpdashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenll
    pqqitprmmcvgflsggvdscqgdaggplssveadgrifqagvvswgdgcaqrnkpgvyt
    rlplfrdwikentgv