PDB entry 5lyg

View 5lyg on RCSB PDB site
Description: crystal structure of intracellular b30.2 domain of btn3a1 bound to malonate
Class: signaling protein
Keywords: B30.2, butyrophilin, signaling protein
Deposited on 2016-09-28, released 2017-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1, BTF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lyga_
  • Heterogens: EDO, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lygA (A:)
    saynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlg
    cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
    prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
    alticpa