PDB entry 5lyc

View 5lyc on RCSB PDB site
Description: Cytochrome c in complex with phosphonato-calix[6]arene
Class: oxidoreductase
Keywords: Calixarene, dimer, surface-binding, oxidoreductase
Deposited on 2016-09-27, released 2017-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d5lyca_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d5lycb1, d5lycb2
  • Heterogens: HEC, 7AZ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lycA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lycA (A:)
    efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
    vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lycB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate