PDB entry 5lyc
View 5lyc on RCSB PDB site
Description: Cytochrome c in complex with phosphonato-calix[6]arene
Class: oxidoreductase
Keywords: Calixarene, dimer, surface-binding, oxidoreductase
Deposited on
2016-09-27, released
2017-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-09-25, with a file datestamp of
2019-09-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
Gene: CYC1, YJR048W, J1653
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (1-107)
- engineered mutation (106)
Domains in SCOPe 2.08: d5lyca_ - Chain 'B':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
Gene: CYC1, YJR048W, J1653
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (1-107)
- expression tag (0)
- engineered mutation (106)
Domains in SCOPe 2.08: d5lycb1, d5lycb2 - Heterogens: HEC, 7AZ, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5lycA (A:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
Sequence, based on observed residues (ATOM records): (download)
>5lycA (A:)
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5lycB (B:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate