PDB entry 5ly7

View 5ly7 on RCSB PDB site
Description: Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin
Class: gene regulation
Keywords: Cell-Wall Recycling Beta-hexosaminidase Pseudomonas aeruginosa Inhibitor, gene regulation
Deposited on 2016-09-25, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: nagZ, PA3005
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (19)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ly7a1, d5ly7a2
  • Chain 'B':
    Compound: Beta-hexosaminidase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: nagZ, PA3005
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (19)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ly7b1, d5ly7b2
  • Heterogens: PEG, NOK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ly7A (A:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadsavaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ly7A (A:)
    hmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdlll
    avdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvld
    ldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadsavaipe
    darsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdg
    vifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrl
    qrmrgkgyantdyrqqprwlealsalraaqlid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ly7B (B:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadsavaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ly7B (B:)
    hmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdlll
    avdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvld
    ldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadsavaipe
    darsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdg
    vifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrl
    qrmrgkgyantdyrqqprwlealsalraaqlid