PDB entry 5ly3

View 5ly3 on RCSB PDB site
Description: p. calidifontis crenactin in complex with arcadin-2 c-terminal peptide
Deposited on 2016-09-23, released 2016-11-30
The last revision was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin/actin family protein
    Species: PYROBACULUM CALIDIFONTIS [TaxId:181486]
    Gene: Pcal_1635
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Actin-like protein
    Species: Pyrobaculum calidifontis [TaxId:410359]
    Gene: Pcal_1636
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ly3A (A:)
    mgvisdayrlkytfgvdfgtsyvkygpitlnepkmvqtrglflrdlpesvkmrippdvla
    rglvvgdeevrkylssvrdvqrnlkyplkdgvarrddeeawrvlkelarytlaqfpvsdp
    efagwlvavalsalapdymykaifdiydelasefkiyavtilpqplavaiaenavncviv
    egghgniqvapisfalireglvalnrggaeanaitreilkdigysdiareeyavevvkra
    vglvprrlkeairaaksdpdrfvtkvrlspvveveipreyawtrfligeivfdpnheeik
    syieqsrlrienavigdvtlygemdvasaiitslrnvsveiqervasqiilsggafswrv
    ppgmedvaadsvtrvkialeekspalaskvevrlvsepqysvwrgaviygyalplslews
    dttregwrfprr
    

    Sequence, based on observed residues (ATOM records):
    >5ly3A (A:)
    isdayrlkytfgvdfgtsyvkygpitlnepkmvqtrglflrdlpesvkmrippdvlargl
    vvgdeevrkylssvrdvqrnlkyplkdgvarrddeeawrvlkelarytlaqfpvsdpefa
    gwlvavalsalapdymykaifdiydelasefkiyavtilpqplavaiaenavncvivegg
    hgniqvapisfalireglvalnrggaeanaitreilkdigysdiareeyavevvkravgl
    vprrlkeairaaksdpdrfvtkvrlspvveveipreyawtrfligeivfdpnheeiksyi
    eqsrlrienavigdvtlygemdvasaiitslrnvsveiqervasqiilsggafswrvppg
    medvaadsvtrvkialeekspalaskvevrlvsepqysvwrgaviygyalplslewsdtt
    regwrfp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5ly3B (B:)
    ggigenewvkilrskr