PDB entry 5lxx

View 5lxx on RCSB PDB site
Description: high-resolution structure of human collapsin response mediator protein 2
Deposited on 2016-09-23, released 2017-01-11
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydropyrimidinase-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DPYSL2, CRMP2, ULIP2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Dihydropyrimidinase-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DPYSL2, CRMP2, ULIP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, BTB, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lxxA (A:)
    mhhhhhhssgvdlgtenlyfqsmtsdrllikggkivnddqsfyadiymedglikqigenl
    ivpggvktieahsrmvipggidvhtrfqmpdqgmtsaddffqgtkaalaggttmiidhvv
    pepgtsllaafdqwrewadsksccdyslhvdisewhkgiqeemealvkdhgvnsflvyma
    fkdrfqltdcqiyevlsvirdigaiaqvhaengdiiaeeqqrildlgitgpeghvlsrpe
    eveaeavnraitianqtncplyitkvmskssaeviaqarkkgtvvygepitaslgtdgsh
    ywsknwakaaafvtspplspdpttpdflnsllscgdlqvtgsahctfntaqkavgkdnft
    lipegtngteermsviwdkavvtgkmdenqfvavtstnaakvfnlyprkgriavgsdadl
    viwdpdsvktisakthnssleynifegmecrgsplvvisqgkivledgtlhvtegsgryi
    prkpfpdfvykrikarsrlae
    

    Sequence, based on observed residues (ATOM records):
    >5lxxA (A:)
    sdrllikggkivnddqsfyadiymedglikqigenlivpggvktieahsrmvipggidvh
    trfqmpdqgmtsaddffqgtkaalaggttmiidhvvpepgtsllaafdqwrewadskscc
    dyslhvdisewhkgiqeemealvkdhgvnsflvymafkdrfqltdcqiyevlsvirdiga
    iaqvhaengdiiaeeqqrildlgitgpeghvlsrpeeveaeavnraitianqtncplyit
    kvmskssaeviaqarkkgtvvygepitaslgtdgshywsknwakaaafvtspplspdptt
    pdflnsllscgdlqvtgsahctfntaqkavgkdnftlipegtngteermsviwdkavvtg
    kmdenqfvavtstnaakvfnlyprkgriavgsdadlviwdpdsvktisakthnssleyni
    fegmecrgsplvvisqgkivledgtlhvtegsgryiprkpfpdfvykrikarsrlae
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lxxB (B:)
    mhhhhhhssgvdlgtenlyfqsmtsdrllikggkivnddqsfyadiymedglikqigenl
    ivpggvktieahsrmvipggidvhtrfqmpdqgmtsaddffqgtkaalaggttmiidhvv
    pepgtsllaafdqwrewadsksccdyslhvdisewhkgiqeemealvkdhgvnsflvyma
    fkdrfqltdcqiyevlsvirdigaiaqvhaengdiiaeeqqrildlgitgpeghvlsrpe
    eveaeavnraitianqtncplyitkvmskssaeviaqarkkgtvvygepitaslgtdgsh
    ywsknwakaaafvtspplspdpttpdflnsllscgdlqvtgsahctfntaqkavgkdnft
    lipegtngteermsviwdkavvtgkmdenqfvavtstnaakvfnlyprkgriavgsdadl
    viwdpdsvktisakthnssleynifegmecrgsplvvisqgkivledgtlhvtegsgryi
    prkpfpdfvykrikarsrlae
    

    Sequence, based on observed residues (ATOM records):
    >5lxxB (B:)
    drllikggkivnddqsfyadiymedglikqigenlivpggvktieahsrmvipggidvht
    rfqmpdqgmtsaddffqgtkaalaggttmiidhvvpepgtsllaafdqwrewadsksccd
    yslhvdisewhkgiqeemealvkdhgvnsflvymafkdrfqltdcqiyevlsvirdigai
    aqvhaengdiiaeeqqrildlgitgpeghvlsrpeeveaeavnraitianqtncplyitk
    vmskssaeviaqarkkgtvvygepitaslgtdgshywsknwakaaafvtspplspdpttp
    dflnsllscgdlqvtgsahctfntaqkavgkdnftlipegtngteermsviwdkavvtgk
    mdenqfvavtstnaakvfnlyprkgriavgsdadlviwdpdsvktisakthnssleynif
    egmecrgsplvvisqgkivledgtlhvtegsgryiprkpfpdfvykrikarsrlae