PDB entry 5lxf

View 5lxf on RCSB PDB site
Description: Crystal structure of the human Macrophage Colony Stimulating Factor M- CSF_C31S variant
Class: signaling protein
Keywords: Drug design, rational protein engineering, receptor tyrosine kinase, osteoporosis, signaling protein
Deposited on 2016-09-21, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09603
      • engineered mutation (42)
    Domains in SCOPe 2.07: d5lxfa_
  • Chain 'B':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09603
      • engineered mutation (42)
    Domains in SCOPe 2.07: d5lxfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lxfA (A:)
    yvdykddddkefeevseycshmigsghlqslqrlidsqmetssqitfefvdqeqlkdpvc
    ylkkafllvqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfye
    tplqllekvknvfnetknlldkdwnifskncnnsfaecssqgherqsegsprhhhhhhaa
    an
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxfA (A:)
    evseycshmigsghlqslqrlidsqmetssqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaecs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lxfB (B:)
    yvdykddddkefeevseycshmigsghlqslqrlidsqmetssqitfefvdqeqlkdpvc
    ylkkafllvqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfye
    tplqllekvknvfnetknlldkdwnifskncnnsfaecssqgherqsegsprhhhhhhaa
    an
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxfB (B:)
    evseycshmigsghlqslqrlidsqmetssqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaecssqg