PDB entry 5lxe

View 5lxe on RCSB PDB site
Description: F420-dependent glucose-6-phosphate dehydrogenase from Rhodococcus jostii RHA1
Class: oxidoreductase
Keywords: F420, glucose-6-phosphate dehydrogenase, TIM barrel, bacterial luciferase family, oxidoreductase
Deposited on 2016-09-20, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-dependent glucose-6-phosphate dehydrogenase 1
    Species: Rhodococcus jostii (strain RHA1) [TaxId:101510]
    Gene: fgd1, RHA1_ro11062
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lxea_
  • Chain 'B':
    Compound: F420-dependent glucose-6-phosphate dehydrogenase 1
    Species: Rhodococcus jostii (strain RHA1) [TaxId:101510]
    Gene: fgd1, RHA1_ro11062
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lxeb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lxeA (A:)
    mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
    gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
    wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
    aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
    alentrfwaplsltpeqkhsiddpiemeraadalpieqvakrwivasdpdeavaqirpyl
    daglnhlvfhapghdqkrflelfqrdlaprlrgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxeA (A:)
    mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
    gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
    wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
    aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
    alentrfwaplslpiemeraadalpieqvakrwivasdpdeavaqirpyldaglnhlvfh
    apghdqkrflelfqrdlaprlrgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lxeB (B:)
    mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
    gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
    wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
    aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
    alentrfwaplsltpeqkhsiddpiemeraadalpieqvakrwivasdpdeavaqirpyl
    daglnhlvfhapghdqkrflelfqrdlaprlrgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxeB (B:)
    mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
    gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
    wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
    aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
    alentrfwaakrwivasdpdeavaqirpyldaglnhlvfhapghdqkrflelfqrdlapr
    lrgl