PDB entry 5lxd

View 5lxd on RCSB PDB site
Description: crystal structure of dyrk2 in complex with eht 1610 (compound 2)
Deposited on 2016-09-20, released 2016-10-26
The last revision was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity tyrosine-phosphorylation-regulated kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DYRK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Dual specificity tyrosine-phosphorylation-regulated kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DYRK2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 7A7, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lxdA (A:)
    smgkvkatpmtpeqamkqymqkltafehheifsypeiyflglnakkrqgmtggpnnggyd
    ddqgsyvqvphdhvayryevlkvigkgsfgqvvkaydhkvhqhvalkmvrnekrfhrqaa
    eeirilehlrkqdkdntmnvihmlenftfrnhicmtfellsmnlyelikknkfqgfslpl
    vrkfahsilqcldalhknriihcdlkpenillkqqgrsgikvidfgsscyehqrvytyiq
    srfyrapevilgarygmpidmwslgcilaelltgypllpgedegdqlacmiellgmpsqk
    lldaskraknfvsskgypryctvttlsdgsvvlnggrsrrgklrgppesrewgnalkgcd
    dplfldflkqclewdpavrmtpgqalrhpwlrrrlpkpptgektsvkr
    

    Sequence, based on observed residues (ATOM records):
    >5lxdA (A:)
    pmtpeqamkqymqkltafehheifsypeiyflglnakkrqgmtggpnnggydddqgsyvq
    vphdhvayryevlkvigkgsfgqvvkaydhkvhqhvalkmvrnekrfhrqaaeeirileh
    lrkqdkdntmnvihmlenftfrnhicmtfellsmnlyelikknkfqgfslplvrkfahsi
    lqcldalhknriihcdlkpenillkqqgrsgikvidfgsscyehqrvytyiqsrfyrape
    vilgarygmpidmwslgcilaelltgypllpgedegdqlacmiellgmpsqklldaskra
    knfvsskgypryctvttlsdgsvvlnggrsrrgklrgppesrewgnalkgcddplfldfl
    kqclewdpavrmtpgqalrhpwlrrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lxdB (B:)
    smgkvkatpmtpeqamkqymqkltafehheifsypeiyflglnakkrqgmtggpnnggyd
    ddqgsyvqvphdhvayryevlkvigkgsfgqvvkaydhkvhqhvalkmvrnekrfhrqaa
    eeirilehlrkqdkdntmnvihmlenftfrnhicmtfellsmnlyelikknkfqgfslpl
    vrkfahsilqcldalhknriihcdlkpenillkqqgrsgikvidfgsscyehqrvytyiq
    srfyrapevilgarygmpidmwslgcilaelltgypllpgedegdqlacmiellgmpsqk
    lldaskraknfvsskgypryctvttlsdgsvvlnggrsrrgklrgppesrewgnalkgcd
    dplfldflkqclewdpavrmtpgqalrhpwlrrrlpkpptgektsvkr
    

    Sequence, based on observed residues (ATOM records):
    >5lxdB (B:)
    pmtpeqamkqymqkltafehheifsypeiyflglnakkrqgmtggpnnggydddqgsyvq
    vphdhvayryevlkvigkgsfgqvvkaydhkvhqhvalkmvrnekrfhrqaaeeirileh
    lrkqdkdntmnvihmlenftfrnhicmtfellsmnlyelikknkfqgfslplvrkfahsi
    lqcldalhknriihcdlkpenillkqqgrsgikvidfgsscyehqrvytyiqsrfyrape
    vilgarygmpidmwslgcilaelltgypllpgedegdqlacmiellgmpsqklldaskra
    knfvsskgypryctvttlsdgsvvlnggrsrrgklrgppesrewgnalkgcddplfldfl
    kqclewdpavrmtpgqalrhpwlrrr