PDB entry 5lxb

View 5lxb on RCSB PDB site
Description: Crystal structure of a mutant binding protein (5HTBP-AChBP) in complex with palonosetron
Class: acetylcholine binding protein
Keywords: Cys-loop receptor, 5-HT3 receptor, acetylcholine binding protein
Deposited on 2016-09-20, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxba_
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbb_
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbc_
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbd_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbe_
  • Chain 'F':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbf_
  • Chain 'G':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbg_
  • Chain 'H':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbh_
  • Chain 'I':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbi_
  • Chain 'J':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8
      • conflict (59)
      • conflict (71)
      • conflict (73)
      • conflict (154)
    Domains in SCOPe 2.07: d5lxbj_
  • Heterogens: NAG, 7A9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lxbA (A:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbA (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lxbB (B:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbB (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lxbC (C:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbC (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lxbD (D:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbD (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lxbE (E:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbE (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lxbF (F:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbF (F:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lxbG (G:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbG (G:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5lxbH (H:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbH (H:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5lxbI (I:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbI (I:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5lxbJ (J:)
    mlvsvylallvacvgqahsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkv
    dsstnevdlvywerqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvls
    pqiavvthdgsvmfipaqrlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqv
    dlssyyasskyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxbJ (J:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer