PDB entry 5lx0

View 5lx0 on RCSB PDB site
Description: cys-gly dipeptidase glij (space group p3221)
Deposited on 2016-09-19, released 2017-05-31
The last revision was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidase
    Species: Aspergillus fumigatus [TaxId:746128]
    Gene: AFUA_6G09650
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lx0A (A:)
    msgshhhhhhsgsmspspieeqatrllkevplidghndfpymirgwfrndingqdahlyd
    mpigqtdlqrlqkgllggqfwsafvpcpknpdkevgslealrqtlqqldvihrlierhpt
    ilqfadsaasiwssfragrvasligieglhqiadsvsalrmlhrlgvryvtlthnchnaf
    adaatvspelhgglsrkgerlirelnrmgmmidlshtsheaqtqalrlsrapviyshssi
    yslraharnvtdenlhllhrnrgvvmicflrellaseadqatlahvidhiiyagtrigye
    hvgigsdfdgmlrgpdglhdvscypalvagllergvseedvkrvmglnvirvleeverva
    aelqgageeclcdeldevwnedikeqltrerervrklgpq
    

    Sequence, based on observed residues (ATOM records):
    >5lx0A (A:)
    spieeqatrllkevplidghndfpymirgwfrndingqdahlydmpigqtdlqrlqkgll
    ggqfwsafvpcpknpdkevgslealrqtlqqldvihrlierhptilqfadsaasiwssfr
    agrvasligieglhqiadsvsalrmlhrlgvryvtlthnchnafadaatvspelhgglsr
    kgerlirelnrmgmmidlshtsheaqtqalrlsrapviyshssiyslraharnvtdenlh
    llhrnrgvvmicflrellaseadqatlahvidhiiyagtrigyehvgigsdfdgmlrgpd
    glhdvscypalvagllergvseedvkrvmglnvirvleevervaaelqgageeclcdeld
    evwnedikeqltrerervrkl